Representative Sequence

SPROT P37551

Pur operon repressor (9619)

1
61
121
181
241
MKFRRSGRLVDLTNYLLTHPHELIPLTFFSERYESAKSSISEDLTIIKQTFEQQGIGTLL TVPGAAGGVKYIPKMKQAEAEEFVQTLGQSLANPERILPGGYVYLTDILGKPSVLSKVGK LFASVFAEREIDVVMTVATKGIPLAYAAASYLNVPVVIVRKDNKVTEGSTVSINYVSGSS NRIQTMSLAKRSMKTGSNVLIIDDFMKAGGTINGMINLLDEFNANVAGIGVLVEAEGVDE RLVDEYMSLLTLSTINMKEKSIEIQNGNFLRFFKDNLLKNGETES 60
120
180
240
285

Domains PDB ID RegionMethodResolution
Representative SP domain (8002991)
Pur operon repressor

Bacillus subtilis (1423)

 P37551 2-276

Derived from SCOP domain 92484
rasmol icon 1O57 A:2-276 X-RAY DIFFRACTION 2.20
Clustered domains rasmol icon 1O57 B:2-274 The ends of this domain were trimmed X-RAY DIFFRACTION 2.20
rasmol icon 1O57 C:2-274 The ends of this domain were trimmed X-RAY DIFFRACTION 2.20
rasmol icon 1O57 D:2-276 X-RAY DIFFRACTION 2.20
rasmol icon 1P4A A:2-276 X-RAY DIFFRACTION 2.22
rasmol icon 1P4A B:2-273 The ends of this domain were trimmed X-RAY DIFFRACTION 2.22
rasmol icon 1P4A C:2-273 The ends of this domain were trimmed X-RAY DIFFRACTION 2.22
rasmol icon 1P4A D:2-273 The ends of this domain were trimmed X-RAY DIFFRACTION 2.22
Representative PR domain (8002992)
Pur operon repressor

Bacillus subtilis (1423)

 P37551 2-276

Derived from SCOP domain 92484
rasmol icon 1O57 A:2-276 X-RAY DIFFRACTION 2.20
Clustered domains rasmol icon 1O57 B:2-274 The ends of this domain were trimmed X-RAY DIFFRACTION 2.20
rasmol icon 1O57 C:2-274 The ends of this domain were trimmed X-RAY DIFFRACTION 2.20
rasmol icon 1O57 D:2-276 X-RAY DIFFRACTION 2.20
rasmol icon 1P4A A:2-276 X-RAY DIFFRACTION 2.22
rasmol icon 1P4A B:2-273 The ends of this domain were trimmed X-RAY DIFFRACTION 2.22
rasmol icon 1P4A C:2-273 The ends of this domain were trimmed X-RAY DIFFRACTION 2.22
rasmol icon 1P4A D:2-273 The ends of this domain were trimmed X-RAY DIFFRACTION 2.22
Representative FA domain (8002993)
Pur operon repressor

Bacillus subtilis (1423)

 P37551 75-276

Derived from SCOP domain 92484
rasmol icon 1O57 A:75-276 X-RAY DIFFRACTION 2.20
Clustered domains rasmol icon 1O57 B:75-274 The ends of this domain were trimmed X-RAY DIFFRACTION 2.20
rasmol icon 1O57 C:75-274 The ends of this domain were trimmed X-RAY DIFFRACTION 2.20
rasmol icon 1O57 D:75-276 X-RAY DIFFRACTION 2.20
rasmol icon 1P4A A:75-276 X-RAY DIFFRACTION 2.22
rasmol icon 1P4A B:75-273 The ends of this domain were trimmed X-RAY DIFFRACTION 2.22
rasmol icon 1P4A C:75-273 The ends of this domain were trimmed X-RAY DIFFRACTION 2.22
rasmol icon 1P4A D:75-273 The ends of this domain were trimmed X-RAY DIFFRACTION 2.22
Representative SF domain (8002994)
Pur operon repressor

Bacillus subtilis (1423)

 P37551 75-276

Derived from SCOP domain 92484
rasmol icon 1O57 A:75-276 X-RAY DIFFRACTION 2.20
Clustered domains rasmol icon 1O57 B:75-274 The ends of this domain were trimmed X-RAY DIFFRACTION 2.20
rasmol icon 1O57 C:75-274 The ends of this domain were trimmed X-RAY DIFFRACTION 2.20
rasmol icon 1O57 D:75-276 X-RAY DIFFRACTION 2.20
rasmol icon 1P4A A:75-276 X-RAY DIFFRACTION 2.22
rasmol icon 1P4A B:75-273 The ends of this domain were trimmed X-RAY DIFFRACTION 2.22
rasmol icon 1P4A C:75-273 The ends of this domain were trimmed X-RAY DIFFRACTION 2.22
rasmol icon 1P4A D:75-273 The ends of this domain were trimmed X-RAY DIFFRACTION 2.22
Representative CF domain (8002995)
Pur operon repressor

Bacillus subtilis (1423)

 P37551 130-253

Derived from SCOP domain 92484
rasmol icon 1O57 A:130-253 X-RAY DIFFRACTION 2.20
Clustered domains rasmol icon 1O57 B:130-253 X-RAY DIFFRACTION 2.20
rasmol icon 1O57 C:130-253 X-RAY DIFFRACTION 2.20
rasmol icon 1O57 D:130-253 X-RAY DIFFRACTION 2.20
rasmol icon 1P4A A:130-253 X-RAY DIFFRACTION 2.22
rasmol icon 1P4A B:130-253 X-RAY DIFFRACTION 2.22
rasmol icon 1P4A C:130-253 X-RAY DIFFRACTION 2.22
rasmol icon 1P4A D:130-253 X-RAY DIFFRACTION 2.22
Representative SF domain (8002996)
Pur operon repressor

Bacillus subtilis (1423)

 P37551 2-74

Derived from SCOP domain 92483
rasmol icon 1O57 A:2-74 X-RAY DIFFRACTION 2.20
Clustered domains rasmol icon 1O57 B:2-74 X-RAY DIFFRACTION 2.20
rasmol icon 1O57 C:2-74 X-RAY DIFFRACTION 2.20
rasmol icon 1O57 D:2-74 X-RAY DIFFRACTION 2.20
rasmol icon 1P4A A:2-74 X-RAY DIFFRACTION 2.22
rasmol icon 1P4A B:2-74 X-RAY DIFFRACTION 2.22
rasmol icon 1P4A C:2-74 X-RAY DIFFRACTION 2.22
rasmol icon 1P4A D:2-74 X-RAY DIFFRACTION 2.22
Representative HF domain (8002997)
Pur operon repressor

Bacillus subtilis (1423)

 P37551 2-56

Derived from SCOP domain 92483
rasmol icon 1O57 A:2-56 X-RAY DIFFRACTION 2.20
Clustered domains rasmol icon 1O57 B:2-56 X-RAY DIFFRACTION 2.20
rasmol icon 1O57 C:2-56 X-RAY DIFFRACTION 2.20
rasmol icon 1O57 D:2-56 X-RAY DIFFRACTION 2.20
rasmol icon 1P4A A:2-56 X-RAY DIFFRACTION 2.22
rasmol icon 1P4A B:2-56 X-RAY DIFFRACTION 2.22
rasmol icon 1P4A C:2-56 X-RAY DIFFRACTION 2.22
rasmol icon 1P4A D:2-56 X-RAY DIFFRACTION 2.22
Representative IR domain (8004002)
Pur operon repressor

Bacillus subtilis (1423)

 P37551 25-46

Derived from SCOP domain 92484
rasmol icon 1O57 A:25-46 X-RAY DIFFRACTION 2.20
Clustered domains rasmol icon 1O57 B:25-46 X-RAY DIFFRACTION 2.20
rasmol icon 1O57 C:25-46 X-RAY DIFFRACTION 2.20
rasmol icon 1O57 D:25-46 X-RAY DIFFRACTION 2.20
rasmol icon 1P4A A:25-46 X-RAY DIFFRACTION 2.22
rasmol icon 1P4A B:25-46 X-RAY DIFFRACTION 2.22
rasmol icon 1P4A C:25-46 X-RAY DIFFRACTION 2.22
rasmol icon 1P4A D:25-46 X-RAY DIFFRACTION 2.22
Representative CF domain (8004261)
Pur operon repressor

Bacillus subtilis (1423)

 P37551 2-74

Derived from SCOP domain 92483
rasmol icon 1O57 A:2-74 X-RAY DIFFRACTION 2.20
Clustered domains rasmol icon 1O57 B:2-74 X-RAY DIFFRACTION 2.20
rasmol icon 1O57 C:2-74 X-RAY DIFFRACTION 2.20
rasmol icon 1O57 D:2-74 X-RAY DIFFRACTION 2.20
rasmol icon 1P4A A:2-74 X-RAY DIFFRACTION 2.22
rasmol icon 1P4A B:2-74 X-RAY DIFFRACTION 2.22
rasmol icon 1P4A C:2-74 X-RAY DIFFRACTION 2.22
rasmol icon 1P4A D:2-74 X-RAY DIFFRACTION 2.22