Representative Sequence

SPROT Q9WY73

UDP-N-acetylmuramate--L-alanine ligase (9638)

1
61
121
181
241
301
361
421
MKIHFVGIGGIGMSAVALHEFSNGNDVYGSNIEETERTAYLRKLGIPIFVPHSADNWYDP DLVIKTPAVRDDNPEIVRARMERVPIENRLHYFRDTLKREKKEEFAVTGTDGKTTTTAMV AHVLKHLRKSPTVFLGGIMDSLEHGNYEKGNGPVVYELDESEEFFSEFSPNYLIITNARG DHLENYGNSLTRYRSAFEKISRNTDLVVTFAEDELTSHLGDVTFGVKKGTYTLEMRSASR AEQKAMVEKNGKRYLELKLKVPGFHNVLNALAVIALFDSLGYDLAPVLEALEEFRGVHRR FSIAFHDPETNIYVIDDYAHTPDEIRNLLQTAKEVFENEKIVVIFQPHRYSRLEREDGNF AKALQLADEVVVTEVYDAFEEKKNGISGKMIWDSLKSLGKEAYFVEKLPELEKVISVSEN TVFLFVGAGDIIYSSRRFVERYQSSKSSPSRVLGSNK 60
120
180
240
300
360
420
457

Domains PDB ID RegionMethodResolution
Representative SP domain (8003629)
UDP-N-acetylmuramate--L-alanine ligase
complexed with mse

Thermotoga maritima (2336)

 Q9WY73 1-446

Derived from SCOP domain 77094
rasmol icon 1J6U A:1-446 X-RAY DIFFRACTION 2.30
Representative PR domain (8003630)
UDP-N-acetylmuramate--L-alanine ligase
complexed with mse

Thermotoga maritima (2336)

 Q9WY73 1-442

Derived from SCOP domain 77094
rasmol icon 1J6U A:1-442 X-RAY DIFFRACTION 2.30
Representative FA domain (8003631)
UDP-N-acetylmuramate--L-alanine ligase
complexed with mse

Thermotoga maritima (2336)

 Q9WY73 1-442

Derived from SCOP domain 77094
rasmol icon 1J6U A:1-442 X-RAY DIFFRACTION 2.30
Representative SF domain (8003632)
UDP-N-acetylmuramate--L-alanine ligase
complexed with mse

Thermotoga maritima (2336)

 Q9WY73 89-442

Derived from SCOP domain 77094
rasmol icon 1J6U A:89-442 X-RAY DIFFRACTION 2.30
Representative CF domain (8003633)
UDP-N-acetylmuramate--L-alanine ligase
complexed with mse

Thermotoga maritima (2336)

 Q9WY73 296-442

Derived from SCOP domain 77094
rasmol icon 1J6U A:296-442 X-RAY DIFFRACTION 2.30
Representative SF domain (8003634)
UDP-N-acetylmuramate--L-alanine ligase
complexed with mse

Thermotoga maritima (2336)

 Q9WY73 1-88

Derived from SCOP domain 77094
rasmol icon 1J6U A:1-88 X-RAY DIFFRACTION 2.30
Representative CF domain (8003635)
UDP-N-acetylmuramate--L-alanine ligase
complexed with mse

Thermotoga maritima (2336)

 Q9WY73 1-88

Derived from SCOP domain 77094
rasmol icon 1J6U A:1-88 X-RAY DIFFRACTION 2.30
Representative HF domain (8003639)
UDP-N-acetylmuramate--L-alanine ligase
complexed with mse

Thermotoga maritima (2336)

 Q9WY73 102-282

Derived from SCOP domain 77094
rasmol icon 1J6U A:102-282 X-RAY DIFFRACTION 2.30
Representative CF domain (8004388)
UDP-N-acetylmuramate--L-alanine ligase
complexed with mse

Thermotoga maritima (2336)

 Q9WY73 89-295

Derived from SCOP domain 77094
rasmol icon 1J6U A:89-295 X-RAY DIFFRACTION 2.30