Representative Sequence

SPROT P07237

Protein disulfide-isomerase (9683)

1
61
121
181
241
301
361
421
481
MLRRALLCLAVAALVRADAPEEEDHVLVLRKSNFAEALAAHKYLLVEFYAPWCGHCKALA PEYAKAAGKLKAEGSEIRLAKVDATEESDLAQQYGVRGYPTIKFFRNGDTASPKEYTAGR EADDIVNWLKKRTGPAATTLPDGAAAESLVESSEVAVIGFFKDVESDSAKQFLQAAEAID DIPFGITSNSDVFSKYQLDKDGVVLFKKFDEGRNNFEGEVTKENLLDFIKHNQLPLVIEF TEQTAPKIFGGEIKTHILLFLPKSVSDYDGKLSNFKTAAESFKGKILFIFIDSDHTDNQR ILEFFGLKKEECPAVRLITLEEEMTKYKPESEELTAERITEFCHRFLEGKIKPHLMSQEL PEDWDKQPVKVLVGKNFEDVAFDEKKNVFVEFYAPWCGHCKQLAPIWDKLGETYKDHENI VIAKMDSTANEVEAVKVHSFPTLKFFPASADRTVIDYNGERTLDGFKKFLESGGQDGAGD DDDLEDLEEAEEPDMEEDDDQKAVKDEL 60
120
180
240
300
360
420
480
508

Domains PDB ID RegionMethodResolution
Representative SP domain (8002732)
Protein disulfide-isomerase
corresponds to the 2nd and 3rd domains of yeast PDI (2B5E)

Homo sapiens (9606)

 P07237 135-357

Derived from SCOP domain 32776
rasmol icon 2K18 A:6-228 SOLUTION NMR n/a
Clustered domains rasmol icon 1BJX A:119-228 The ends of this domain were trimmed SOLUTION NMR n/a
rasmol icon 2BJX A:119-228 The ends of this domain were trimmed SOLUTION NMR n/a
rasmol icon 3BJ5 A:219-340 The ends of this domain were trimmed X-RAY DIFFRACTION 2.20
rasmol icon 3UEM A:137-357 The ends of this domain were trimmed X-RAY DIFFRACTION 2.29
rasmol icon 4EKZ A:135-357 Some residues were not observed X-RAY DIFFRACTION 2.510
rasmol icon 4EL1 A:135-357 Some residues were not observed X-RAY DIFFRACTION 2.883
rasmol icon 4EL1 B:135-357 Some residues were not observed X-RAY DIFFRACTION 2.883
rasmol icon 4JU5 A:136-347 Some residues were not observed X-RAY DIFFRACTION 2.28
rasmol icon 4JU5 B:136-347 The ends of this domain were trimmed X-RAY DIFFRACTION 2.28
Representative SP domain (8002733)
Protein disulfide-isomerase
corresponds to the 1st domain of yeast PDI (2B5E)

Homo sapiens (9606)

 P07237 18-137

Derived from SCOP domain 32776
rasmol icon 1MEK A:1-120 SOLUTION NMR n/a
Clustered domains rasmol icon 4EKZ A:18-137 X-RAY DIFFRACTION 2.510
rasmol icon 4EL1 A:18-137 X-RAY DIFFRACTION 2.883
rasmol icon 4EL1 B:18-137 X-RAY DIFFRACTION 2.883
Representative SP domain (8002734)
Protein disulfide-isomerase
corresponds to the 4th domain of yeast PDI (2B5E)

Homo sapiens (9606)

 P07237 368-475

Derived from SCOP domain 32776
rasmol icon 1X5C A:8-115 SOLUTION NMR n/a
Clustered domains rasmol icon 3UEM A:368-475 X-RAY DIFFRACTION 2.29
rasmol icon 4EKZ A:368-475 X-RAY DIFFRACTION 2.510
rasmol icon 4EL1 A:368-475 X-RAY DIFFRACTION 2.883
rasmol icon 4EL1 B:368-475 X-RAY DIFFRACTION 2.883