Representative Sequence

SPROT P05455

Lupus La protein (9684)

1
61
121
181
241
301
361
MAENGDNEKMAALEAKICHQIEYYFGDFNLPRDKFLKEQIKLDEGWVPLEIMIKFNRLNR LTTDFNVIVEALSKSKAELMEISEDKTKIRRSPSKPLPEVTDEYKNDVKNRSVYIKGFPT DATLDDIKEWLEDKGQVLNIQMRRTLHKAFKGSIFVVFDSIESAKKFVETPGQKYKETDL LILFKDDYFAKKNEERKQNKVEAKLRAKQEQEAKQKLEEDAEMKSLEEKIGCLLKFSGDL DDQTCREDLHILFSNHGEIKWIDFVRGAKEGIILFKEKAKEALGKAKDANNGNLQLRNKE VTWEVLEGEVEKEALKKIIEDQQESLNKWKSKGRRFKGKGKGNKAAQPGSGKGKVQFQGK KTKFASDDEHDEHDENGATGPVKRAREETDKEEPASKQQKTENGAGDQ 60
120
180
240
300
360
408

Domains PDB ID RegionMethodResolution
Representative PR domain (8003162)
Lupus La protein
complexed with so4

Homo sapiens (9606)

 P05455 5-189

Derived from SCOP domain 125073
rasmol icon 1ZH5 A:5-189 X-RAY DIFFRACTION 1.85
Clustered domains rasmol icon 1S79 A:105-189 The ends of this domain were trimmed SOLUTION NMR n/a
rasmol icon 1S7A A:5-103 The ends of this domain were trimmed SOLUTION NMR n/a
rasmol icon 1YTY A:6-189 The ends of this domain were trimmed X-RAY DIFFRACTION 2.29
rasmol icon 1YTY B:7-189 The ends of this domain were trimmed X-RAY DIFFRACTION 2.29
rasmol icon 1ZH5 B:6-189 The ends of this domain were trimmed X-RAY DIFFRACTION 1.85
rasmol icon 2VOD A:6-189 The ends of this domain were trimmed X-RAY DIFFRACTION 2.10
rasmol icon 2VOD B:5-189 X-RAY DIFFRACTION 2.10
rasmol icon 2VON A:6-189 The ends of this domain were trimmed X-RAY DIFFRACTION 2.1
rasmol icon 2VON B:7-189 The ends of this domain were trimmed X-RAY DIFFRACTION 2.1
rasmol icon 2VOO A:10-188 The ends of this domain were trimmed X-RAY DIFFRACTION 1.80
rasmol icon 2VOO B:9-185 The ends of this domain were trimmed X-RAY DIFFRACTION 1.80
rasmol icon 2VOP A:8-189 The ends of this domain were trimmed X-RAY DIFFRACTION 2.8
Representative FA domain (8003163)
Lupus La protein
complexed with so4

Homo sapiens (9606)

 P05455 5-96

Derived from SCOP domain 125073
rasmol icon 1ZH5 A:5-96 X-RAY DIFFRACTION 1.85
Clustered domains rasmol icon 1S7A A:5-96 SOLUTION NMR n/a
rasmol icon 1YTY A:6-96 The ends of this domain were trimmed X-RAY DIFFRACTION 2.29
rasmol icon 1YTY B:7-96 The ends of this domain were trimmed X-RAY DIFFRACTION 2.29
rasmol icon 1ZH5 B:6-96 The ends of this domain were trimmed X-RAY DIFFRACTION 1.85
rasmol icon 2VOD A:6-96 The ends of this domain were trimmed X-RAY DIFFRACTION 2.10
rasmol icon 2VOD B:5-96 X-RAY DIFFRACTION 2.10
rasmol icon 2VON A:6-96 The ends of this domain were trimmed X-RAY DIFFRACTION 2.1
rasmol icon 2VON B:7-96 The ends of this domain were trimmed X-RAY DIFFRACTION 2.1
rasmol icon 2VOO A:10-96 The ends of this domain were trimmed X-RAY DIFFRACTION 1.80
rasmol icon 2VOO B:9-96 The ends of this domain were trimmed X-RAY DIFFRACTION 1.80
rasmol icon 2VOP A:8-96 The ends of this domain were trimmed X-RAY DIFFRACTION 2.8
Representative SF domain (8003164)
Lupus La protein
complexed with so4

Homo sapiens (9606)

 P05455 5-92

Derived from SCOP domain 125073
rasmol icon 1ZH5 A:5-92 X-RAY DIFFRACTION 1.85
Clustered domains rasmol icon 1S7A A:5-92 SOLUTION NMR n/a
rasmol icon 1YTY A:6-92 The ends of this domain were trimmed X-RAY DIFFRACTION 2.29
rasmol icon 1YTY B:7-92 The ends of this domain were trimmed X-RAY DIFFRACTION 2.29
rasmol icon 1ZH5 B:6-92 The ends of this domain were trimmed X-RAY DIFFRACTION 1.85
rasmol icon 2VOD A:6-92 The ends of this domain were trimmed X-RAY DIFFRACTION 2.10
rasmol icon 2VOD B:5-92 X-RAY DIFFRACTION 2.10
rasmol icon 2VON A:6-92 The ends of this domain were trimmed X-RAY DIFFRACTION 2.1
rasmol icon 2VON B:7-92 The ends of this domain were trimmed X-RAY DIFFRACTION 2.1
rasmol icon 2VOO A:10-92 The ends of this domain were trimmed X-RAY DIFFRACTION 1.80
rasmol icon 2VOO B:9-92 The ends of this domain were trimmed X-RAY DIFFRACTION 1.80
rasmol icon 2VOP A:8-92 The ends of this domain were trimmed X-RAY DIFFRACTION 2.8
Representative HF domain (8003165)
Lupus La protein
complexed with so4

Homo sapiens (9606)

 P05455 5-75

Derived from SCOP domain 125073
rasmol icon 1ZH5 A:5-75 X-RAY DIFFRACTION 1.85
Clustered domains rasmol icon 1S7A A:5-75 SOLUTION NMR n/a
rasmol icon 1YTY A:6-75 The ends of this domain were trimmed X-RAY DIFFRACTION 2.29
rasmol icon 1YTY B:7-75 The ends of this domain were trimmed X-RAY DIFFRACTION 2.29
rasmol icon 1ZH5 B:6-75 The ends of this domain were trimmed X-RAY DIFFRACTION 1.85
rasmol icon 2VOD A:6-75 The ends of this domain were trimmed X-RAY DIFFRACTION 2.10
rasmol icon 2VOD B:5-75 X-RAY DIFFRACTION 2.10
rasmol icon 2VON A:6-75 The ends of this domain were trimmed X-RAY DIFFRACTION 2.1
rasmol icon 2VON B:7-75 The ends of this domain were trimmed X-RAY DIFFRACTION 2.1
rasmol icon 2VOO A:10-75 The ends of this domain were trimmed X-RAY DIFFRACTION 1.80
rasmol icon 2VOO B:9-75 The ends of this domain were trimmed X-RAY DIFFRACTION 1.80
rasmol icon 2VOP A:8-75 The ends of this domain were trimmed X-RAY DIFFRACTION 2.8
Representative FA domain (8003166)
Lupus La protein
complexed with so4

Homo sapiens (9606)

 P05455 112-184

Derived from SCOP domain 125074
rasmol icon 1ZH5 A:112-184 X-RAY DIFFRACTION 1.85
Clustered domains rasmol icon 1S79 A:112-184 SOLUTION NMR n/a
rasmol icon 1YTY A:112-184 X-RAY DIFFRACTION 2.29
rasmol icon 1YTY B:112-184 X-RAY DIFFRACTION 2.29
rasmol icon 1ZH5 B:112-184 X-RAY DIFFRACTION 1.85
rasmol icon 2VOD A:112-184 X-RAY DIFFRACTION 2.10
rasmol icon 2VOD B:112-184 X-RAY DIFFRACTION 2.10
rasmol icon 2VON A:112-184 X-RAY DIFFRACTION 2.1
rasmol icon 2VON B:112-184 X-RAY DIFFRACTION 2.1
rasmol icon 2VOO A:112-184 X-RAY DIFFRACTION 1.80
rasmol icon 2VOO B:112-184 X-RAY DIFFRACTION 1.80
rasmol icon 2VOP A:112-184 X-RAY DIFFRACTION 2.8
Representative SF domain (8003167)
Lupus La protein
complexed with so4

Homo sapiens (9606)

 P05455 112-184

Derived from SCOP domain 125074
rasmol icon 1ZH5 A:112-184 X-RAY DIFFRACTION 1.85
Clustered domains rasmol icon 1S79 A:112-184 SOLUTION NMR n/a
rasmol icon 1YTY A:112-184 X-RAY DIFFRACTION 2.29
rasmol icon 1YTY B:112-184 X-RAY DIFFRACTION 2.29
rasmol icon 1ZH5 B:112-184 X-RAY DIFFRACTION 1.85
rasmol icon 2VOD A:112-184 X-RAY DIFFRACTION 2.10
rasmol icon 2VOD B:112-184 X-RAY DIFFRACTION 2.10
rasmol icon 2VON A:112-184 X-RAY DIFFRACTION 2.1
rasmol icon 2VON B:112-184 X-RAY DIFFRACTION 2.1
rasmol icon 2VOO A:112-184 X-RAY DIFFRACTION 1.80
rasmol icon 2VOO B:112-184 X-RAY DIFFRACTION 1.80
rasmol icon 2VOP A:112-184 X-RAY DIFFRACTION 2.8
Representative CF domain (8003168)
Lupus La protein
complexed with so4

Homo sapiens (9606)

 P05455 112-184

Derived from SCOP domain 125074
rasmol icon 1ZH5 A:112-184 X-RAY DIFFRACTION 1.85
Clustered domains rasmol icon 1S79 A:112-184 SOLUTION NMR n/a
rasmol icon 1YTY A:112-184 X-RAY DIFFRACTION 2.29
rasmol icon 1YTY B:112-184 X-RAY DIFFRACTION 2.29
rasmol icon 1ZH5 B:112-184 X-RAY DIFFRACTION 1.85
rasmol icon 2VOD A:112-184 X-RAY DIFFRACTION 2.10
rasmol icon 2VOD B:112-184 X-RAY DIFFRACTION 2.10
rasmol icon 2VON A:112-184 X-RAY DIFFRACTION 2.1
rasmol icon 2VON B:112-184 X-RAY DIFFRACTION 2.1
rasmol icon 2VOO A:112-184 X-RAY DIFFRACTION 1.80
rasmol icon 2VOO B:112-184 X-RAY DIFFRACTION 1.80
rasmol icon 2VOP A:112-184 X-RAY DIFFRACTION 2.8
Representative PR domain (8003518)
Lupus La protein

Homo sapiens (9606)

 P05455 225-334

Derived from SCOP domain 87494
rasmol icon 1OWX A:225-334 SOLUTION NMR n/a
Representative FA domain (8003519)
Lupus La protein

Homo sapiens (9606)

 P05455 232-310

Derived from SCOP domain 87494
rasmol icon 1OWX A:232-310 SOLUTION NMR n/a
Representative CF domain (8004285)
Lupus La protein
complexed with so4

Homo sapiens (9606)

 P05455 5-92

Derived from SCOP domain 125073
rasmol icon 1ZH5 A:5-92 X-RAY DIFFRACTION 1.85
Clustered domains rasmol icon 1S7A A:5-92 SOLUTION NMR n/a
rasmol icon 1YTY A:6-92 The ends of this domain were trimmed X-RAY DIFFRACTION 2.29
rasmol icon 1YTY B:7-92 The ends of this domain were trimmed X-RAY DIFFRACTION 2.29
rasmol icon 1ZH5 B:6-92 The ends of this domain were trimmed X-RAY DIFFRACTION 1.85
rasmol icon 2VOD A:6-92 The ends of this domain were trimmed X-RAY DIFFRACTION 2.10
rasmol icon 2VOD B:5-92 X-RAY DIFFRACTION 2.10
rasmol icon 2VON A:6-92 The ends of this domain were trimmed X-RAY DIFFRACTION 2.1
rasmol icon 2VON B:7-92 The ends of this domain were trimmed X-RAY DIFFRACTION 2.1
rasmol icon 2VOO A:10-92 The ends of this domain were trimmed X-RAY DIFFRACTION 1.80
rasmol icon 2VOO B:9-92 The ends of this domain were trimmed X-RAY DIFFRACTION 1.80
rasmol icon 2VOP A:8-92 The ends of this domain were trimmed X-RAY DIFFRACTION 2.8