Representative Sequence

SPROT P14859

POU domain, class 2, transcription factor 1 (9708)

1
61
121
181
241
301
361
421
481
541
601
661
721
MNNPSETSKPSMESGDGNTGTQTNGLDFQKQPVPVGGAISTAQAQAFLGHLHQVQLAGTS LQAAAQSLNVQSKSNEESGDSQQPSQPSQQPSVQAAIPQTQLMLAGGQITGLTLTPAQQQ LLLQQAQAQAQLLAAAVQQHSASQQHSAAGATISASAATPMTQIPLSQPIQIAQDLQQLQ QLQQQNLNLQQFVLVHPTTNLQPAQFIISQTPQGQQGLLQAQNLLTQLPQQSQANLLQSQ PSITLTSQPATPTRTIAATPIQTLPQSQSTPKRIDTPSLEEPSDLEELEQFAKTFKQRRI KLGFTQGDVGLAMGKLYGNDFSQTTISRFEALNLSFKNMCKLKPLLEKWLNDAENLSSDS SLSSPSALNSPGIEGLSRRRKKRTSIETNIRVALEKSFLENQKPTSEEITMIADQLNMEK EVIRVWFCNRRQKEKRINPPSSGGTSSSPIKAIFPSPTSLVATTPSLVTSSAATTLTVSP VLPLTSAAVTNLSVTGTSDTTSNNTATVISTAPPASSAVTSPSLSPSPSASASTSEASSA SETSTTQTTSTPLSSPLGTSQVMVTASGLQTAAAAALQGAAQLPANASLAAMAAAAGLNP SLMAPSQFAAGGALLSLNPGTLSGALSPALMSNSTLATIQALASGGSLPITSLDATGNLV FANAGGAPNIVTAPLFLNPQNLSLLTSNPVSLVSAAAASAGNSAPVASLHATSTSAESIQ NSLFTVASASGAASTTTTASKAQ 60
120
180
240
300
360
420
480
540
600
660
720
743

Domains PDB ID RegionMethodResolution
Representative PR domain (8002397)
POU domain, class 2, transcription factor 1
complex with DNA

Homo sapiens (9606)

 P14859 280-438

Derived from SCOP domain 59197
rasmol icon 1E3O C:1-160 X-RAY DIFFRACTION 1.9
Clustered domains rasmol icon 1CQT A:2-160 The ends of this domain were trimmed X-RAY DIFFRACTION 3.20
rasmol icon 1CQT B:505-660 The ends of this domain were trimmed X-RAY DIFFRACTION 3.20
rasmol icon 1GT0 C:3-159 The ends of this domain were trimmed X-RAY DIFFRACTION 2.60
rasmol icon 1HF0 A:6-159 Some residues were not observed X-RAY DIFFRACTION 2.7
rasmol icon 1HF0 B:6-159 Some residues were not observed X-RAY DIFFRACTION 2.7
rasmol icon 1O4X A:5-163 Some residues were not observed SOLUTION NMR n/a
rasmol icon 1OCT C:5-160 Some residues were not observed X-RAY DIFFRACTION 3.000
rasmol icon 1POG A:1-60 The ends of this domain were trimmed SOLUTION NMR n/a
rasmol icon 1POU A:5-75 The ends of this domain were trimmed SOLUTION NMR n/a
Representative FA domain (8002398)
POU domain, class 2, transcription factor 1

Homo sapiens (9606)

 P14859 386-437

Derived from SCOP domain 59197
rasmol icon 1E3O C:108-159 X-RAY DIFFRACTION 1.9
Clustered domains rasmol icon 1CQT A:108-159 X-RAY DIFFRACTION 3.20
rasmol icon 1CQT B:608-659 X-RAY DIFFRACTION 3.20
rasmol icon 1GT0 C:108-159 X-RAY DIFFRACTION 2.60
rasmol icon 1HF0 A:108-159 X-RAY DIFFRACTION 2.7
rasmol icon 1HF0 B:108-159 X-RAY DIFFRACTION 2.7
rasmol icon 1O4X A:111-162 SOLUTION NMR n/a
rasmol icon 1OCT C:108-159 X-RAY DIFFRACTION 3.000
rasmol icon 1POG A:9-60 SOLUTION NMR n/a
Representative FA domain (8002399)
POU domain, class 2, transcription factor 1

Homo sapiens (9606)

 P14859 280-354

Derived from SCOP domain 59198
rasmol icon 1E3O C:1-75 X-RAY DIFFRACTION 1.9
Clustered domains rasmol icon 1CQT A:2-75 The ends of this domain were trimmed X-RAY DIFFRACTION 3.20
rasmol icon 1CQT B:505-575 The ends of this domain were trimmed X-RAY DIFFRACTION 3.20
rasmol icon 1GT0 C:3-75 The ends of this domain were trimmed X-RAY DIFFRACTION 2.60
rasmol icon 1HF0 A:6-75 The ends of this domain were trimmed X-RAY DIFFRACTION 2.7
rasmol icon 1HF0 B:6-75 The ends of this domain were trimmed X-RAY DIFFRACTION 2.7
rasmol icon 1O4X A:5-79 SOLUTION NMR n/a
rasmol icon 1OCT C:5-75 The ends of this domain were trimmed X-RAY DIFFRACTION 3.000
rasmol icon 1POU A:5-75 The ends of this domain were trimmed SOLUTION NMR n/a
Representative SF domain (8017633)
POU domain, class 2, transcription factor 1

Homo sapiens (9606)

 P14859 280-354

Derived from SCOP domain 59198
rasmol icon 1E3O C:1-75 X-RAY DIFFRACTION 1.9
Clustered domains rasmol icon 1CQT A:2-75 The ends of this domain were trimmed X-RAY DIFFRACTION 3.20
rasmol icon 1CQT B:505-575 The ends of this domain were trimmed X-RAY DIFFRACTION 3.20
rasmol icon 1GT0 C:3-75 The ends of this domain were trimmed X-RAY DIFFRACTION 2.60
rasmol icon 1HF0 A:6-75 The ends of this domain were trimmed X-RAY DIFFRACTION 2.7
rasmol icon 1HF0 B:6-75 The ends of this domain were trimmed X-RAY DIFFRACTION 2.7
rasmol icon 1O4X A:5-79 SOLUTION NMR n/a
rasmol icon 1OCT C:5-75 The ends of this domain were trimmed X-RAY DIFFRACTION 3.000
rasmol icon 1POU A:5-75 The ends of this domain were trimmed SOLUTION NMR n/a
Representative CF domain (8017634)
POU domain, class 2, transcription factor 1

Homo sapiens (9606)

 P14859 280-354

Derived from SCOP domain 59198
rasmol icon 1E3O C:1-75 X-RAY DIFFRACTION 1.9
Clustered domains rasmol icon 1CQT A:2-75 The ends of this domain were trimmed X-RAY DIFFRACTION 3.20
rasmol icon 1CQT B:505-575 The ends of this domain were trimmed X-RAY DIFFRACTION 3.20
rasmol icon 1GT0 C:3-75 The ends of this domain were trimmed X-RAY DIFFRACTION 2.60
rasmol icon 1HF0 A:6-75 The ends of this domain were trimmed X-RAY DIFFRACTION 2.7
rasmol icon 1HF0 B:6-75 The ends of this domain were trimmed X-RAY DIFFRACTION 2.7
rasmol icon 1O4X A:5-79 SOLUTION NMR n/a
rasmol icon 1OCT C:5-75 The ends of this domain were trimmed X-RAY DIFFRACTION 3.000
rasmol icon 1POU A:5-75 The ends of this domain were trimmed SOLUTION NMR n/a
Representative SF domain (8017635)
POU domain, class 2, transcription factor 1

Homo sapiens (9606)

 P14859 386-437

Derived from SCOP domain 59197
rasmol icon 1E3O C:108-159 X-RAY DIFFRACTION 1.9
Clustered domains rasmol icon 1CQT A:108-159 X-RAY DIFFRACTION 3.20
rasmol icon 1CQT B:608-659 X-RAY DIFFRACTION 3.20
rasmol icon 1GT0 C:108-159 X-RAY DIFFRACTION 2.60
rasmol icon 1HF0 A:108-159 X-RAY DIFFRACTION 2.7
rasmol icon 1HF0 B:108-159 X-RAY DIFFRACTION 2.7
rasmol icon 1O4X A:111-162 SOLUTION NMR n/a
rasmol icon 1OCT C:108-159 X-RAY DIFFRACTION 3.000
rasmol icon 1POG A:9-60 SOLUTION NMR n/a
Representative CF domain (8017636)
POU domain, class 2, transcription factor 1

Homo sapiens (9606)

 P14859 386-437

Derived from SCOP domain 59197
rasmol icon 1E3O C:108-159 X-RAY DIFFRACTION 1.9
Clustered domains rasmol icon 1CQT A:108-159 X-RAY DIFFRACTION 3.20
rasmol icon 1CQT B:608-659 X-RAY DIFFRACTION 3.20
rasmol icon 1GT0 C:108-159 X-RAY DIFFRACTION 2.60
rasmol icon 1HF0 A:108-159 X-RAY DIFFRACTION 2.7
rasmol icon 1HF0 B:108-159 X-RAY DIFFRACTION 2.7
rasmol icon 1O4X A:111-162 SOLUTION NMR n/a
rasmol icon 1OCT C:108-159 X-RAY DIFFRACTION 3.000
rasmol icon 1POG A:9-60 SOLUTION NMR n/a
Representative HF domain (8017637)
POU domain, class 2, transcription factor 1

Homo sapiens (9606)

 P14859 386-437

Derived from SCOP domain 59197
rasmol icon 1E3O C:108-159 X-RAY DIFFRACTION 1.9
Clustered domains rasmol icon 1CQT A:108-159 X-RAY DIFFRACTION 3.20
rasmol icon 1CQT B:608-659 X-RAY DIFFRACTION 3.20
rasmol icon 1GT0 C:108-159 X-RAY DIFFRACTION 2.60
rasmol icon 1HF0 A:108-159 X-RAY DIFFRACTION 2.7
rasmol icon 1HF0 B:108-159 X-RAY DIFFRACTION 2.7
rasmol icon 1O4X A:111-162 SOLUTION NMR n/a
rasmol icon 1OCT C:108-159 X-RAY DIFFRACTION 3.000
rasmol icon 1POG A:9-60 SOLUTION NMR n/a