Representative Sequence

SPROT P10037

Pituitary-specific positive transcription factor 1 (9709)

1
61
121
181
241
MSCQPFTSADTFIPLNSDASAALPLRMHHSAAEGLPASNHATNVMSTATGLHYSVPSCHY GNQPSTYGVMAGTLTPCLYKFPDHTLSHGFPPLHQPLLAEDPTASEFKQELRRKSKLVEE PIDMDSPEIRELEQFANEFKVRRIKLGYTQTNVGEALAAVHGSEFSQTTICRFENLQLSF KNACKLKAILSKWLEEAEQVGALYNEKVGANERKRKRRTTISIAAKDALERHFGEHSKPS SQEIMRMAEELNLEKEVVRVWFCNRRQREKRVKTSLNQSLFSISKEHLECR 60
120
180
240
291

Domains PDB ID RegionMethodResolution
Representative PR domain (8002380)
Pituitary-specific positive transcription factor 1

Rattus norvegicus (10116)

 P10037 132-273

Derived from SCOP domain 15995
rasmol icon 1AU7 A:9-160 X-RAY DIFFRACTION 2.300
Clustered domains rasmol icon 1AU7 B:9-160 Some residues were not observed X-RAY DIFFRACTION 2.300
Representative FA domain (8002381)
Pituitary-specific positive transcription factor 1

Rattus norvegicus (10116)

 P10037 221-272

Derived from SCOP domain 15995
rasmol icon 1AU7 A:108-159 X-RAY DIFFRACTION 2.300
Clustered domains rasmol icon 1AU7 B:108-159 X-RAY DIFFRACTION 2.300
Representative FA domain (8002382)
Pituitary-specific positive transcription factor 1

Rattus norvegicus (10116)

 P10037 132-199

Derived from SCOP domain 17021
rasmol icon 1AU7 A:9-76 X-RAY DIFFRACTION 2.300
Clustered domains rasmol icon 1AU7 B:9-74 The ends of this domain were trimmed X-RAY DIFFRACTION 2.300
Representative SF domain (8003751)
Pituitary-specific positive transcription factor 1

Rattus norvegicus (10116)

 P10037 132-199

Derived from SCOP domain 17021
rasmol icon 1AU7 A:9-76 X-RAY DIFFRACTION 2.300
Clustered domains rasmol icon 1AU7 B:9-74 The ends of this domain were trimmed X-RAY DIFFRACTION 2.300
Representative CF domain (8003752)
Pituitary-specific positive transcription factor 1

Rattus norvegicus (10116)

 P10037 132-199

Derived from SCOP domain 17021
rasmol icon 1AU7 A:9-76 X-RAY DIFFRACTION 2.300
Clustered domains rasmol icon 1AU7 B:9-74 The ends of this domain were trimmed X-RAY DIFFRACTION 2.300
Representative SF domain (8017638)
Pituitary-specific positive transcription factor 1

Rattus norvegicus (10116)

 P10037 221-272

Derived from SCOP domain 15995
rasmol icon 1AU7 A:108-159 X-RAY DIFFRACTION 2.300
Clustered domains rasmol icon 1AU7 B:108-159 X-RAY DIFFRACTION 2.300
Representative CF domain (8017639)
Pituitary-specific positive transcription factor 1

Rattus norvegicus (10116)

 P10037 221-272

Derived from SCOP domain 15995
rasmol icon 1AU7 A:108-159 X-RAY DIFFRACTION 2.300
Clustered domains rasmol icon 1AU7 B:108-159 X-RAY DIFFRACTION 2.300
Representative HF domain (8017640)
Pituitary-specific positive transcription factor 1

Rattus norvegicus (10116)

 P10037 221-272

Derived from SCOP domain 15995
rasmol icon 1AU7 A:108-159 X-RAY DIFFRACTION 2.300
Clustered domains rasmol icon 1AU7 B:108-159 X-RAY DIFFRACTION 2.300