Representative Sequence

SPROT P20823

Hepatocyte nuclear factor 1-alpha (9768)

1
61
121
181
241
301
361
421
481
541
601
MVSKLSQLQTELLAALLESGLSKEALIQALGEPGPYLLAGEGPLDKGESCGGGRGELAEL PNGLGETRGSEDETDDDGEDFTPPILKELENLSPEEAAHQKAVVETLLQEDPWRVAKMVK SYLQQHNIPQREVVDTTGLNQSHLSQHLNKGTPMKTQKRAALYTWYVRKQREVAQQFTHA GQGGLIEEPTGDELPTKKGRRNRFKWGPASQQILFQAYERQKNPSKEERETLVEECNRAE CIQRGVSPSQAQGLGSNLVTEVRVYNWFANRRKEEAFRHKLAMDTYSGPPPGPGPGPALP AHSSPGLPPPALSPSKVHGVRYGQPATSETAEVPSSSGGPLVTVSTPLHQVSPTGLEPSH SLLSTEAKLVSAAGGPLPPVSTLTALHSLEQTSPGLNQQPQNLIMASLPGVMTIGPGEPA SLGPTFTNTGASTLVIGLASTQAQSVPVINSMGSSLTTLQPVQFSQPLHPSYQQPLMPPV QSHVTQSPFMATMAQLQSPHALYSHKPEVAQYTHTGLLPQTMLITDTTNLSALASLTPTK QVFTSDTEASSESGLHTPASQATTLHVPSQDPAGIQHLQPAHRLSASPTVSSSSLVLYQS SDSSNGQSHLLPSNHSVIETFISTQMASSSQ 60
120
180
240
300
360
420
480
540
600
631

Domains PDB ID RegionMethodResolution
Representative PR domain (8002391)
Hepatocyte nuclear factor 1-alpha

Homo sapiens (9606)

 P20823 87-276

Derived from SCOP domain 76740
rasmol icon 1IC8 A:87-276 X-RAY DIFFRACTION 2.6
Clustered domains rasmol icon 1IC8 B:87-276 X-RAY DIFFRACTION 2.6
Representative FA domain (8002393)
Hepatocyte nuclear factor 1-alpha

Homo sapiens (9606)

 P20823 206-276

Derived from SCOP domain 76740
rasmol icon 1IC8 A:206-276 X-RAY DIFFRACTION 2.6
Clustered domains rasmol icon 1IC8 B:206-276 X-RAY DIFFRACTION 2.6
Representative FA domain (8002394)
Hepatocyte nuclear factor 1-alpha

Homo sapiens (9606)

 P20823 111-180

Derived from SCOP domain 76741
rasmol icon 1IC8 A:111-180 X-RAY DIFFRACTION 2.6
Clustered domains rasmol icon 1IC8 B:111-180 X-RAY DIFFRACTION 2.6
Representative SF domain (8017654)
Hepatocyte nuclear factor 1-alpha

Homo sapiens (9606)

 P20823 206-276

Derived from SCOP domain 76740
rasmol icon 1IC8 A:206-276 X-RAY DIFFRACTION 2.6
Clustered domains rasmol icon 1IC8 B:206-276 X-RAY DIFFRACTION 2.6
Representative CF domain (8017655)
Hepatocyte nuclear factor 1-alpha

Homo sapiens (9606)

 P20823 206-276

Derived from SCOP domain 76740
rasmol icon 1IC8 A:206-276 X-RAY DIFFRACTION 2.6
Clustered domains rasmol icon 1IC8 B:206-276 X-RAY DIFFRACTION 2.6
Representative HF domain (8017656)
Hepatocyte nuclear factor 1-alpha

Homo sapiens (9606)

 P20823 206-276

Derived from SCOP domain 76740
rasmol icon 1IC8 A:206-276 X-RAY DIFFRACTION 2.6
Clustered domains rasmol icon 1IC8 B:206-276 X-RAY DIFFRACTION 2.6
Representative SF domain (8017657)
Hepatocyte nuclear factor 1-alpha

Homo sapiens (9606)

 P20823 111-180

Derived from SCOP domain 76741
rasmol icon 1IC8 A:111-180 X-RAY DIFFRACTION 2.6
Clustered domains rasmol icon 1IC8 B:111-180 X-RAY DIFFRACTION 2.6
Representative CF domain (8017658)
Hepatocyte nuclear factor 1-alpha

Homo sapiens (9606)

 P20823 111-180

Derived from SCOP domain 76741
rasmol icon 1IC8 A:111-180 X-RAY DIFFRACTION 2.6
Clustered domains rasmol icon 1IC8 B:111-180 X-RAY DIFFRACTION 2.6