Representative Sequence

SPROT P07636

Transposase (9812)

1
61
121
181
241
301
361
421
481
541
601
661
MELWVSPKECANLPGLPKTSAGVIYVAKKQGWQNRTRAGVKGGKAIEYNANSLPVEAKAA LLLRQGEIETSLGYFEIARPTLEAHDYDREALWSKWDNASDSQRRLAEKWLPAVQAADEM LNQGISTKTAFATVAGHYQVSASTLRDKYYQVQKFAKPDWAAALVDGRGASRRNVHKSEF DEDAWQFLIADYLRPEKPAFRKCYERLELAAREHGWSIPSRATAFRRIQQLDEAMVVACR EGEHALMHLIPAQQRTVEHLDAMQWINGDGYLHNVFVRWFNGDVIRPKTWFWQDVKTRKI LGWRCDVSENIDSIRLSFMDVVTRYGIPEDFHITIDNTRGAANKWLTGGAPNRYRFKVKE DDPKGLFLLMGAKMHWTSVVAGKGWGQAKPVERAFGVGGLEEYVDKHPALAGAYTGPNPQ AKPDNYGDRAVDAELFLKTLAEGVAMFNARTGRETEMCGGKLSFDDVFEREYARTIVRKP TEEQKRMLLLPAEAVNVSRKGEFTLKVGGSLKGAKNVYYNMALMNAGVKKVVVRFDPQQL HSTVYCYTLDGRFICEAECLAPVAFNDAAAGREYRRRQKQLKSATKAAIKAQKQMDALEV AELLPQIAEPAAPESRIVGIFRPSGNTERVKNQERDDEYETERDEYLNHSLDILEQNRRK KAI 60
120
180
240
300
360
420
480
540
600
660
663

Domains PDB ID RegionMethodResolution
Representative PR domain (8003602)
Transposase

Escherichia virus Mu (10677)

 P07636 77-174

Derived from SCOP domain 16026
rasmol icon 2EZL A:77-174 SOLUTION NMR n/a
Clustered domains rasmol icon 2EZK A:77-168 The ends of this domain were trimmed SOLUTION NMR n/a
rasmol icon 4FCY A:88-165 The ends of this domain were trimmed X-RAY DIFFRACTION 3.706
rasmol icon 4FCY B:88-165 The ends of this domain were trimmed X-RAY DIFFRACTION 3.706
Representative FA domain (8003603)
Transposase

Escherichia virus Mu (10677)

 P07636 99-157

Derived from SCOP domain 16026
rasmol icon 2EZL A:99-157 SOLUTION NMR n/a
Clustered domains rasmol icon 2EZK A:99-157 SOLUTION NMR n/a
rasmol icon 4FCY A:99-157 X-RAY DIFFRACTION 3.706
rasmol icon 4FCY B:99-157 X-RAY DIFFRACTION 3.706
Representative PR domain (8003604)
Transposase

Escherichia virus Mu (10677)

 P07636 174-247

Derived from SCOP domain 16028
rasmol icon 2EZI A:174-247 SOLUTION NMR n/a
Clustered domains rasmol icon 2EZH A:178-242 The ends of this domain were trimmed SOLUTION NMR n/a
rasmol icon 4FCY A:178-247 The ends of this domain were trimmed X-RAY DIFFRACTION 3.706
rasmol icon 4FCY B:178-247 The ends of this domain were trimmed X-RAY DIFFRACTION 3.706
Representative FA domain (8003605)
Transposase

Escherichia virus Mu (10677)

 P07636 180-232

Derived from SCOP domain 16028
rasmol icon 2EZI A:180-232 SOLUTION NMR n/a
Clustered domains rasmol icon 2EZH A:180-232 SOLUTION NMR n/a
rasmol icon 4FCY A:180-232 X-RAY DIFFRACTION 3.706
rasmol icon 4FCY B:180-232 X-RAY DIFFRACTION 3.706
Representative PR domain (8003606)
Transposase

Escherichia virus Mu (10677)

 P07636 258-560

Derived from SCOP domain 33676
rasmol icon 1BCO A:258-560 X-RAY DIFFRACTION 2.4
Clustered domains rasmol icon 1BCM A:258-560 X-RAY DIFFRACTION 2.8
rasmol icon 1BCM B:258-560 X-RAY DIFFRACTION 2.8
rasmol icon 4FCY A:258-560 X-RAY DIFFRACTION 3.706
rasmol icon 4FCY B:258-560 X-RAY DIFFRACTION 3.706
Representative FA domain (8003607)
Transposase

Escherichia virus Mu (10677)

 P07636 258-480

Derived from SCOP domain 33676
rasmol icon 1BCO A:258-480 X-RAY DIFFRACTION 2.4
Clustered domains rasmol icon 1BCM A:258-480 X-RAY DIFFRACTION 2.8
rasmol icon 1BCM B:258-480 X-RAY DIFFRACTION 2.8
rasmol icon 4FCY A:258-480 X-RAY DIFFRACTION 3.706
rasmol icon 4FCY B:258-480 X-RAY DIFFRACTION 3.706
Representative SF domain (8003608)
Transposase

Escherichia virus Mu (10677)

 P07636 264-450

Derived from SCOP domain 33676
rasmol icon 1BCO A:264-450 X-RAY DIFFRACTION 2.4
Clustered domains rasmol icon 1BCM A:264-450 X-RAY DIFFRACTION 2.8
rasmol icon 1BCM B:264-450 X-RAY DIFFRACTION 2.8
rasmol icon 4FCY A:264-450 X-RAY DIFFRACTION 3.706
rasmol icon 4FCY B:264-450 X-RAY DIFFRACTION 3.706
Representative CF domain (8003609)
Transposase

Escherichia virus Mu (10677)

 P07636 264-450

Derived from SCOP domain 33676
rasmol icon 1BCO A:264-450 X-RAY DIFFRACTION 2.4
Clustered domains rasmol icon 1BCM A:264-450 X-RAY DIFFRACTION 2.8
rasmol icon 1BCM B:264-450 X-RAY DIFFRACTION 2.8
rasmol icon 4FCY A:264-450 X-RAY DIFFRACTION 3.706
rasmol icon 4FCY B:264-450 X-RAY DIFFRACTION 3.706
Representative FA domain (8003610)
Transposase

Escherichia virus Mu (10677)

 P07636 481-560

Derived from SCOP domain 26431
rasmol icon 1BCO A:481-560 X-RAY DIFFRACTION 2.4
Clustered domains rasmol icon 1BCM A:481-560 X-RAY DIFFRACTION 2.8
rasmol icon 1BCM B:481-560 X-RAY DIFFRACTION 2.8
rasmol icon 4FCY A:481-560 X-RAY DIFFRACTION 3.706
rasmol icon 4FCY B:481-560 X-RAY DIFFRACTION 3.706
Representative SF domain (8003611)
Transposase

Escherichia virus Mu (10677)

 P07636 481-560

Derived from SCOP domain 26431
rasmol icon 1BCO A:481-560 X-RAY DIFFRACTION 2.4
Clustered domains rasmol icon 1BCM A:481-560 X-RAY DIFFRACTION 2.8
rasmol icon 1BCM B:481-560 X-RAY DIFFRACTION 2.8
rasmol icon 4FCY A:481-560 X-RAY DIFFRACTION 3.706
rasmol icon 4FCY B:481-560 X-RAY DIFFRACTION 3.706
Representative CF domain (8003612)
Transposase

Escherichia virus Mu (10677)

 P07636 489-560

Derived from SCOP domain 26431
rasmol icon 1BCO A:489-560 X-RAY DIFFRACTION 2.4
Clustered domains rasmol icon 1BCM A:489-560 X-RAY DIFFRACTION 2.8
rasmol icon 1BCM B:489-560 X-RAY DIFFRACTION 2.8
rasmol icon 4FCY A:489-560 X-RAY DIFFRACTION 3.706
rasmol icon 4FCY B:489-560 X-RAY DIFFRACTION 3.706