Representative Sequence

SPROT Q03237

Myb-related protein B (9821)

1
61
121
181
241
301
361
421
481
541
601
661
MARRSRGEDQDELHCQDTDSDVPEQRDGRCKVKWTQEEDEQLKMLVRHYGQNDWKFLASH FPNRSDQQCQYRWLRVLNPDLVKGPWTKEEDQKVIELVKKYGTKQWTLIAKHLKGRLGKQ CRERWHNHLNPEVKKSSWTEEEDRIIFEAHKVLGNRWAEIAKLLPGRTDNAVKNHWNSTI KRKVDTGGFLNETKESQPLYLLVEVDDNESQSGTRAESQTIVPNWPVDISEIKEEDVSDE EVTGLQELPSELPAADLAEHNEEGTPDDVVPEDASASVASPYKWVVEAANYLCPTSVPAL NEALDMIESDPDGWCDLTQFDLPEEPSAGSSSSSNSPVRQTPSKPTPSLPNVTEYRLDGH TISDLSKSRKGELIPISPHAEVSFGTPPSVLKRQKKRKISLSPVTENAPSTSLSFLDSCN SMTPKSTPVKTLPFSPSQFLNFWTKQDTLELENPSLTSTPVCSQKVIVTTPLHRDKTPLL QKNSAFVTPDQKYVVDNTPHTPTPFKNALEKYGPIRPLPQTPHLEEDLKEVLRSEAGIEL IIEDDVKPHKQKRKQGLRRSPIKKVRKSLALDIVDEDMTQNMPALPKTICFKRTQPVNFL SRSLNLSSSNRKNDSGLLNRAFVQVQSEKMSYRKMPSHFRPPAPMTRAWKAVACGGTQDQ LFMQEKARQFLGTLKQSHTSRTLILS 60
120
180
240
300
360
420
480
540
600
660
686

Domains PDB ID RegionMethodResolution
Representative PR domain (8002309)
Myb-related protein B

Gallus gallus (9031)

 Q03237 79-186

Derived from SCOP domain 16043
rasmol icon 1A5J A:3-110 SOLUTION NMR n/a
Representative FA domain (8002310)
Myb-related protein B

Gallus gallus (9031)

 Q03237 79-131

Derived from SCOP domain 16043
rasmol icon 1A5J A:3-55 SOLUTION NMR n/a
Representative FA domain (8002311)
Myb-related protein B

Gallus gallus (9031)

 Q03237 132-186

Derived from SCOP domain 16044
rasmol icon 1A5J A:56-110 SOLUTION NMR n/a