Representative Sequence

SPROT P15043

ATP-dependent DNA helicase recQ (9855)

1
61
121
181
241
301
361
421
481
541
601
MAQAEVLNLESGAKQVLQETFGYQQFRPGQEEIIDTVLSGRDCLVVMPTGGGKSLCYQIP ALLLNGLTVVVSPLISLMKDQVDQLQANGVAAACLNSTQTREQQLEVMTGCRTGQIRLLY IAPERLMLDNFLEHLAHWNPVLLAVDEAHCISQWGHDFRPEYAALGQLRQRFPTLPFMAL TATADDTTRQDIVRLLGLNDPLIQISSFDRPNIRYMLMEKFKPLDQLMRYVQEQRGKSGI IYCNSRAKVEDTAARLQSKGISAAAYHAGLENNVRADVQEKFQRDDLQIVVATVAFGMGI NKPNVRFVVHFDIPRNIESYYQETGRAGRDGLPAEAMLFYDPADMAWLRRCLEEKPQGQL QDIERHKLNAMGAFAEAQTCRRLVLLNYFGEGRQEPCGNCDICLDPPKQYDGSTDAQIAL STIGRVNQRFGMGYVVEVIRGANNQRIRDYGHDKLKVYGMGRDKSHEHWVSVIRQLIHLG LVTQNIAQHSALQLTEAARPVLRGESSLQLAVPRIVALKPKAMQKSFGGNYDRKLFAKLR KLRKSIADESNVPPYVVFNDATLIEMAEQMPITASEMLSVNGVGMRKLERFGKPFMALIR AHVDGDDEE 60
120
180
240
300
360
420
480
540
600
609

Domains PDB ID RegionMethodResolution
Representative PR domain (8003031)
ATP-dependent DNA helicase recQ

Escherichia coli (562)

 P15043 4-516

Derived from SCOP domain 93761
rasmol icon 1OYW A:4-516 X-RAY DIFFRACTION 1.8
Clustered domains rasmol icon 1OYY A:4-516 X-RAY DIFFRACTION 2.5
Representative FA domain (8003032)
ATP-dependent DNA helicase recQ

Escherichia coli (562)

 P15043 4-406

Derived from SCOP domain 93761
rasmol icon 1OYW A:4-406 X-RAY DIFFRACTION 1.8
Clustered domains rasmol icon 1OYY A:4-406 X-RAY DIFFRACTION 2.5
Representative SF domain (8003034)
ATP-dependent DNA helicase recQ

Escherichia coli (562)

 P15043 4-206

Derived from SCOP domain 93761
rasmol icon 1OYW A:4-206 X-RAY DIFFRACTION 1.8
Clustered domains rasmol icon 1OYY A:4-206 X-RAY DIFFRACTION 2.5
Representative CF domain (8003035)
ATP-dependent DNA helicase recQ

Escherichia coli (562)

 P15043 4-206

Derived from SCOP domain 93761
rasmol icon 1OYW A:4-206 X-RAY DIFFRACTION 1.8
Clustered domains rasmol icon 1OYY A:4-206 X-RAY DIFFRACTION 2.5
Representative SF domain (8003036)
ATP-dependent DNA helicase recQ

Escherichia coli (562)

 P15043 207-406

Derived from SCOP domain 93762
rasmol icon 1OYW A:207-406 X-RAY DIFFRACTION 1.8
Clustered domains rasmol icon 1OYY A:207-406 X-RAY DIFFRACTION 2.5
Representative CF domain (8003037)
ATP-dependent DNA helicase recQ

Escherichia coli (562)

 P15043 207-406

Derived from SCOP domain 93762
rasmol icon 1OYW A:207-406 X-RAY DIFFRACTION 1.8
Clustered domains rasmol icon 1OYY A:207-406 X-RAY DIFFRACTION 2.5
Representative FA domain (8003038)
ATP-dependent DNA helicase recQ

Escherichia coli (562)

 P15043 407-516

Derived from SCOP domain 93760
rasmol icon 1OYW A:407-516 X-RAY DIFFRACTION 1.8
Clustered domains rasmol icon 1OYY A:407-516 X-RAY DIFFRACTION 2.5
Representative SF domain (8003040)
ATP-dependent DNA helicase recQ

Escherichia coli (562)

 P15043 411-495

Derived from SCOP domain 93760
rasmol icon 1OYW A:411-495 X-RAY DIFFRACTION 1.8
Clustered domains rasmol icon 1OYY A:411-495 X-RAY DIFFRACTION 2.5
Representative HF domain (8003041)
ATP-dependent DNA helicase recQ

Escherichia coli (562)

 P15043 411-481

Derived from SCOP domain 93760
rasmol icon 1OYW A:411-481 X-RAY DIFFRACTION 1.8
Clustered domains rasmol icon 1OYY A:411-481 X-RAY DIFFRACTION 2.5
Representative PR domain (8003488)
ATP-dependent DNA helicase recQ

Escherichia coli (562)

 P15043 530-606

Derived from SCOP domain 121283
rasmol icon 1WUD A:530-606 X-RAY DIFFRACTION 2.20
Clustered domains rasmol icon 1WUD B:531-606 The ends of this domain were trimmed X-RAY DIFFRACTION 2.20
rasmol icon 1WUD D:531-606 The ends of this domain were trimmed X-RAY DIFFRACTION 2.20
Representative FA domain (8003489)
ATP-dependent DNA helicase recQ

Escherichia coli (562)

 P15043 530-606

Derived from SCOP domain 121283
rasmol icon 1WUD A:530-606 X-RAY DIFFRACTION 2.20
Clustered domains rasmol icon 1WUD B:531-606 The ends of this domain were trimmed X-RAY DIFFRACTION 2.20
rasmol icon 1WUD D:531-606 The ends of this domain were trimmed X-RAY DIFFRACTION 2.20
Representative SF domain (8003490)
ATP-dependent DNA helicase recQ

Escherichia coli (562)

 P15043 530-606

Derived from SCOP domain 121283
rasmol icon 1WUD A:530-606 X-RAY DIFFRACTION 2.20
Clustered domains rasmol icon 1WUD B:531-606 The ends of this domain were trimmed X-RAY DIFFRACTION 2.20
rasmol icon 1WUD D:531-606 The ends of this domain were trimmed X-RAY DIFFRACTION 2.20
Representative CF domain (8003491)
ATP-dependent DNA helicase recQ

Escherichia coli (562)

 P15043 530-606

Derived from SCOP domain 121283
rasmol icon 1WUD A:530-606 X-RAY DIFFRACTION 2.20
Clustered domains rasmol icon 1WUD B:531-606 The ends of this domain were trimmed X-RAY DIFFRACTION 2.20
rasmol icon 1WUD D:531-606 The ends of this domain were trimmed X-RAY DIFFRACTION 2.20
Representative CF domain (8004269)
ATP-dependent DNA helicase recQ

Escherichia coli (562)

 P15043 411-495

Derived from SCOP domain 93760
rasmol icon 1OYW A:411-495 X-RAY DIFFRACTION 1.8
Clustered domains rasmol icon 1OYY A:411-495 X-RAY DIFFRACTION 2.5