Representative Sequence

SPROT P34257

Transposable element Tc3 transposase (9895)

1
61
121
181
241
301
MPRGSALSDTERAQLDVMKLLNVSLHEMSRKISRSRHCIREYLKDPVSYGTSKRAPRRKA LSVRDERNVIRAASNSCKTARDIRNELQLSASKRTILNVIKRSGVIVRQKLRPAPLLSAD HKLKRLEFAKNNMGTNWSKVVFSDEKKFNLDGPDGCRYYWRDLRKEPMVFSRRNFGGGTV MVWGAFTEKKKLEIQFVSSKMNSTDYQNVLELELSKYLRHYSRKDFRFQQDNATIHVSNS TRDYFKLKKINLLDWPARSPDLNPIENLWGILVRIVYAQNKTYPTVASLKQGILDAWKSI PDNQLKSLVRSMEDRLIEIIRTQGNPINY 60
120
180
240
300
329

Domains PDB ID RegionMethodResolution
Representative PR domain (8003599)
Transposable element Tc3 transposase
protein/DNA complex, mutant

Caenorhabditis elegans (6239)

 P34257 2-104

Derived from SCOP domain 107712
rasmol icon 1U78 A:2-104 X-RAY DIFFRACTION 2.69
Clustered domains rasmol icon 1TC3 C:202-252 The ends of this domain were trimmed X-RAY DIFFRACTION 2.450
Representative FA domain (8003600)
Transposable element Tc3 transposase
protein/DNA complex, mutant

Caenorhabditis elegans (6239)

 P34257 7-46

Derived from SCOP domain 107712
rasmol icon 1U78 A:7-46 X-RAY DIFFRACTION 2.69
Clustered domains rasmol icon 1TC3 C:207-246 X-RAY DIFFRACTION 2.450
Representative FA domain (8003601)
Transposable element Tc3 transposase
protein/DNA complex, mutant

Caenorhabditis elegans (6239)

 P34257 61-104

Derived from SCOP domain 107713
rasmol icon 1U78 A:61-104 X-RAY DIFFRACTION 2.69
Representative IR domain (8003976)
Transposable element Tc3 transposase
protein/DNA complex, mutant

Caenorhabditis elegans (6239)

 P34257 24-45

Derived from SCOP domain 107713
rasmol icon 1U78 A:24-45 X-RAY DIFFRACTION 2.69
Clustered domains rasmol icon 1TC3 C:224-245 X-RAY DIFFRACTION 2.450