Representative Sequence

SPROT P01104

Transforming protein Myb (9921)

1
61
121
181
241
301
361
NRTDVQCQHRWQKVLNPELNKGPWTKEEDQRVIEHVQKYGPKRWSDIAKHLKGRIGKQCR ERWHNHLNPEVKKTSWTEEEDRIIYQAHKRLGNRWAEIAKLLPGRTDNAVKNHWNSTMRR KVEQEGYPQESSKAGPPSATTGFQKSSHLMAFAHNPPAGPLPGAGQAPLGSDYPYYHIAE PQNVPGQIPYPVALHINIINVPQPAAAAIQRHYTDEDPEKEKRIKELELLLMSTENELKG QQALPTQNHTANYPGWHSTTVADNTRTSGDNAPVSCLGEHHHCTPSPPVDHGCLPEESAS PARCMIVHQSNILDNVKNLLEFAETLQLIDSFLNTSSNHENLNLDNPALTSTPVCGHKMS VTTPFHKDQTFTEYRKMHGGAV 60
120
180
240
300
360
382

Domains PDB ID RegionMethodResolution
Representative PR domain (8002304)
Transforming protein Myb

Avian myeloblastosis virus (11866)

 P01104 16-120

Derived from SCOP domain 65731
rasmol icon 1H8A C:87-191 X-RAY DIFFRACTION 2.23
Representative FA domain (8002305)
Transforming protein Myb

Avian myeloblastosis virus (11866)

 P01104 16-72

Derived from SCOP domain 65731
rasmol icon 1H8A C:87-143 X-RAY DIFFRACTION 2.23
Representative FA domain (8002306)
Transforming protein Myb

Avian myeloblastosis virus (11866)

 P01104 73-120

Derived from SCOP domain 65732
rasmol icon 1H8A C:144-191 X-RAY DIFFRACTION 2.23
Representative IR domain (8003996)
Transforming protein Myb

Avian myeloblastosis virus (11866)

 P01104 43-65

Derived from SCOP domain 65731
rasmol icon 1H8A C:114-136 X-RAY DIFFRACTION 2.23
Representative IR domain (8003997)
Transforming protein Myb

Avian myeloblastosis virus (11866)

 P01104 94-116

Derived from SCOP domain 65731
rasmol icon 1H8A C:165-187 X-RAY DIFFRACTION 2.23