Representative Sequence

SPROT Q9UKL0

REST corepressor 1 (9936)

1
61
121
181
241
301
361
421
481
MVEKGPEVSGKRRGRNNAAASASAAAASAAASAACASPAATAASGAAASSASAAAASAAA APNNGQNKSLAAAAPNGNSSSNSWEEGSSGSSSDEEHGGGGMRVGPQYQAVVPDFDPAKL ARRSQERDNLGMLVWSPNQNLSEAKLDEYIAIAKEKHGYNMEQALGMLFWHKHNIEKSLA DLPNFTPFPDEWTVEDKVLFEQAFSFHGKTFHRIQQMLPDKSIASLVKFYYSWKKTRTKT SVMDRHARKQKREREESEDELEEANGNNPIDIEVDQNKESKKEVPPTETVPQVKKEKHST QAKNRAKRKPPKGMFLSQEDVEAVSANATAATTVLRQLDMELVSVKRQIQNIKQTNSALK EKLDGGIEPYRLPEVIQKCNARWTTEEQLLAVQAIRKYGRDFQAISDVIGNKSVVQVKNF FVNYRRRFNIDEVLQEWEAEHGKEETNGPSNQKPVKSPDNSIKMPEEEDEAPVLDVRYAS AS 60
120
180
240
300
360
420
480
482

Domains PDB ID RegionMethodResolution
Representative PR domain (8002296)
REST corepressor 1
2nd SANT domain preceded by a coil coiled region

Homo sapiens (9606)

 Q9UKL0 308-440

Derived from SCOP domain 137739
rasmol icon 2IW5 B:308-440 X-RAY DIFFRACTION 2.57
Clustered domains rasmol icon 2UXN B:308-440 X-RAY DIFFRACTION 2.72
rasmol icon 2UXX B:308-440 X-RAY DIFFRACTION 2.74
rasmol icon 2V1D B:308-440 X-RAY DIFFRACTION 3.10
rasmol icon 2X0L B:308-440 X-RAY DIFFRACTION 3.00
rasmol icon 2XAF B:308-440 X-RAY DIFFRACTION 3.25
rasmol icon 2XAG B:308-440 X-RAY DIFFRACTION 3.10
rasmol icon 2XAH B:308-440 X-RAY DIFFRACTION 3.10
rasmol icon 2XAJ B:308-440 X-RAY DIFFRACTION 3.30
rasmol icon 2XAQ B:308-440 X-RAY DIFFRACTION 3.20
rasmol icon 2XAS B:308-440 X-RAY DIFFRACTION 3.20
rasmol icon 2Y48 B:308-440 X-RAY DIFFRACTION 3.00
rasmol icon 3ZMS B:308-440 X-RAY DIFFRACTION 2.96
rasmol icon 3ZMT B:308-440 X-RAY DIFFRACTION 3.10
rasmol icon 3ZMU B:308-440 X-RAY DIFFRACTION 3.20
rasmol icon 3ZMV B:308-440 X-RAY DIFFRACTION 3.00
rasmol icon 3ZMZ B:308-440 X-RAY DIFFRACTION 3.00
rasmol icon 3ZN0 B:308-440 X-RAY DIFFRACTION 2.80
rasmol icon 3ZN1 B:308-440 X-RAY DIFFRACTION 3.10
rasmol icon 4BAY B:308-440 X-RAY DIFFRACTION 3.10
rasmol icon 4KUM B:308-440 X-RAY DIFFRACTION 3.05
rasmol icon 4UV8 B:308-440 X-RAY DIFFRACTION 2.80
rasmol icon 4UV9 B:308-440 X-RAY DIFFRACTION 3.00
rasmol icon 4UVA B:308-440 X-RAY DIFFRACTION 2.90
rasmol icon 4UVB B:308-440 X-RAY DIFFRACTION 2.80
rasmol icon 4UVC B:308-440 X-RAY DIFFRACTION 3.10
rasmol icon 4UXN B:308-440 X-RAY DIFFRACTION 2.85
rasmol icon 4XBF B:308-440 X-RAY DIFFRACTION 2.803
rasmol icon 5L3B B:308-440 X-RAY DIFFRACTION 3.30
rasmol icon 5L3C B:308-440 X-RAY DIFFRACTION 3.31
rasmol icon 5L3D B:308-440 X-RAY DIFFRACTION 2.60
rasmol icon 5L3E B:308-440 X-RAY DIFFRACTION 2.80
rasmol icon 5L3F B:308-440 X-RAY DIFFRACTION 3.500
rasmol icon 5L3G B:308-440 X-RAY DIFFRACTION 3.100
rasmol icon 5LBQ B:308-440 X-RAY DIFFRACTION 3.30
Representative FA domain (8002297)
REST corepressor 1

Homo sapiens (9606)

 Q9UKL0 376-440

Derived from SCOP domain 137739
rasmol icon 2IW5 B:376-440 X-RAY DIFFRACTION 2.57
Clustered domains rasmol icon 2UXN B:376-440 X-RAY DIFFRACTION 2.72
rasmol icon 2UXX B:376-440 X-RAY DIFFRACTION 2.74
rasmol icon 2V1D B:376-440 X-RAY DIFFRACTION 3.10
rasmol icon 2X0L B:376-440 X-RAY DIFFRACTION 3.00
rasmol icon 2XAF B:376-440 X-RAY DIFFRACTION 3.25
rasmol icon 2XAG B:376-440 X-RAY DIFFRACTION 3.10
rasmol icon 2XAH B:376-440 X-RAY DIFFRACTION 3.10
rasmol icon 2XAJ B:376-440 X-RAY DIFFRACTION 3.30
rasmol icon 2XAQ B:376-440 X-RAY DIFFRACTION 3.20
rasmol icon 2XAS B:376-440 X-RAY DIFFRACTION 3.20
rasmol icon 2Y48 B:376-440 X-RAY DIFFRACTION 3.00
rasmol icon 3ZMS B:376-440 X-RAY DIFFRACTION 2.96
rasmol icon 3ZMT B:376-440 X-RAY DIFFRACTION 3.10
rasmol icon 3ZMU B:376-440 X-RAY DIFFRACTION 3.20
rasmol icon 3ZMV B:376-440 X-RAY DIFFRACTION 3.00
rasmol icon 3ZMZ B:376-440 X-RAY DIFFRACTION 3.00
rasmol icon 3ZN0 B:376-440 X-RAY DIFFRACTION 2.80
rasmol icon 3ZN1 B:376-440 X-RAY DIFFRACTION 3.10
rasmol icon 4BAY B:376-440 X-RAY DIFFRACTION 3.10
rasmol icon 4KUM B:376-440 X-RAY DIFFRACTION 3.05
rasmol icon 4UV8 B:376-440 X-RAY DIFFRACTION 2.80
rasmol icon 4UV9 B:376-440 X-RAY DIFFRACTION 3.00
rasmol icon 4UVA B:376-440 X-RAY DIFFRACTION 2.90
rasmol icon 4UVB B:376-440 X-RAY DIFFRACTION 2.80
rasmol icon 4UVC B:376-440 X-RAY DIFFRACTION 3.10
rasmol icon 4UXN B:376-440 X-RAY DIFFRACTION 2.85
rasmol icon 4XBF B:376-440 X-RAY DIFFRACTION 2.803
rasmol icon 5L3B B:376-440 X-RAY DIFFRACTION 3.30
rasmol icon 5L3C B:376-440 X-RAY DIFFRACTION 3.31
rasmol icon 5L3D B:376-440 X-RAY DIFFRACTION 2.60
rasmol icon 5L3E B:376-440 X-RAY DIFFRACTION 2.80
rasmol icon 5L3F B:376-440 X-RAY DIFFRACTION 3.500
rasmol icon 5L3G B:376-440 X-RAY DIFFRACTION 3.100
rasmol icon 5LBQ B:376-440 X-RAY DIFFRACTION 3.30
Representative CF domain (8002298)
REST corepressor 1

Homo sapiens (9606)

 Q9UKL0 308-375

Derived from SCOP domain 137739
rasmol icon 2IW5 B:308-375 X-RAY DIFFRACTION 2.57
Clustered domains rasmol icon 2UXN B:308-375 X-RAY DIFFRACTION 2.72
rasmol icon 2UXX B:308-375 X-RAY DIFFRACTION 2.74
rasmol icon 2V1D B:308-375 X-RAY DIFFRACTION 3.10
rasmol icon 2X0L B:308-375 X-RAY DIFFRACTION 3.00
rasmol icon 2XAF B:308-375 X-RAY DIFFRACTION 3.25
rasmol icon 2XAG B:308-375 X-RAY DIFFRACTION 3.10
rasmol icon 2XAH B:308-375 X-RAY DIFFRACTION 3.10
rasmol icon 2XAJ B:308-375 X-RAY DIFFRACTION 3.30
rasmol icon 2XAQ B:308-375 X-RAY DIFFRACTION 3.20
rasmol icon 2XAS B:308-375 X-RAY DIFFRACTION 3.20
rasmol icon 2Y48 B:308-375 X-RAY DIFFRACTION 3.00
rasmol icon 3ZMS B:308-375 X-RAY DIFFRACTION 2.96
rasmol icon 3ZMT B:308-375 X-RAY DIFFRACTION 3.10
rasmol icon 3ZMU B:308-375 X-RAY DIFFRACTION 3.20
rasmol icon 3ZMV B:308-375 X-RAY DIFFRACTION 3.00
rasmol icon 3ZMZ B:308-375 X-RAY DIFFRACTION 3.00
rasmol icon 3ZN0 B:308-375 X-RAY DIFFRACTION 2.80
rasmol icon 3ZN1 B:308-375 X-RAY DIFFRACTION 3.10
rasmol icon 4BAY B:308-375 X-RAY DIFFRACTION 3.10
rasmol icon 4KUM B:308-375 X-RAY DIFFRACTION 3.05
rasmol icon 4UV8 B:308-375 X-RAY DIFFRACTION 2.80
rasmol icon 4UV9 B:308-375 X-RAY DIFFRACTION 3.00
rasmol icon 4UVA B:308-375 X-RAY DIFFRACTION 2.90
rasmol icon 4UVB B:308-375 X-RAY DIFFRACTION 2.80
rasmol icon 4UVC B:308-375 X-RAY DIFFRACTION 3.10
rasmol icon 4UXN B:308-375 X-RAY DIFFRACTION 2.85
rasmol icon 4XBF B:308-375 X-RAY DIFFRACTION 2.803
rasmol icon 5L3B B:308-375 X-RAY DIFFRACTION 3.30
rasmol icon 5L3C B:308-375 X-RAY DIFFRACTION 3.31
rasmol icon 5L3D B:308-375 X-RAY DIFFRACTION 2.60
rasmol icon 5L3E B:308-375 X-RAY DIFFRACTION 2.80
rasmol icon 5L3F B:308-375 X-RAY DIFFRACTION 3.500
rasmol icon 5L3G B:308-375 X-RAY DIFFRACTION 3.100
rasmol icon 5LBQ B:308-375 X-RAY DIFFRACTION 3.30